PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G20110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 464aa    MW: 49207.6 Da    PI: 5.9864
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G20110.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.6e-162370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ed  lv+ v+q+G g+W+++ r+  + R++k+c++rw ++l
  LPERR03G20110.1 23 KGPWTTAEDAELVQHVRQHGEGNWNSVQRMTSLLRCGKSCRLRWTNHL 70
                     79******************************99***********996 PP

2Myb_DNA-binding51.13.2e-1676119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++++E++l++++++qlG++ W++ a++++ gRt++++k++w++
  LPERR03G20110.1  76 KGSFSPDEELLIAQLHAQLGNK-WARMASHLP-GRTDNEIKNYWNT 119
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.4351870IPR017930Myb domain
SuperFamilySSF466893.25E-2821117IPR009057Homeodomain-like
SMARTSM007172.4E-132272IPR001005SANT/Myb domain
PfamPF002491.7E-132370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-202477IPR009057Homeodomain-like
CDDcd001679.61E-112570No hitNo description
PROSITE profilePS5129423.30471125IPR017930Myb domain
SMARTSM007171.1E-1475123IPR001005SANT/Myb domain
PfamPF002494.0E-1576119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-2478124IPR009057Homeodomain-like
CDDcd001676.26E-1178119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MKRAPEEKGE EMGEEEEEVA LKKGPWTTAE DAELVQHVRQ HGEGNWNSVQ RMTSLLRCGK  60
SCRLRWTNHL RPNLKKGSFS PDEELLIAQL HAQLGNKWAR MASHLPGRTD NEIKNYWNTR  120
AKRRQRAGLP IYPPEVQLNH HHLNLNFANA NAKRRRYDDF FSSSSLSPPQ SASASNVLLS  180
PDDAAAAAGY TSARPAPLDL AGQLAMGGNT SGGALQFLAA TPFSAPSSPW AKPFARNAHF  240
FRFPHSSPVS PTTPPTPTTG LSLGGYGLGL YHAGDRTARL FPPVSQSLGA RVELPSTQFR  300
PAMTPAAATG GLAGGGGGAL MQDHPNAASF EAMMQELHDV IKTESPVPAA NGGGETGGVI  360
SGDSKLEVEL KDDIETLFDI IIPATFATAA PESLTATTAA SAPNNSGSVS QHSSDDQDHS  420
NGADVTIDLP VLTGGGGDGD GSSEQEWCID GATCQWNNMS GGIC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-302112425127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0425371e-102BT042537.1 Zea mays full-length cDNA clone ZM_BFb0325G13 mRNA, complete cds.
GenBankKJ7275321e-102KJ727532.1 Zea mays clone pUT5392 MYB transcription factor (MYB129) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629365.11e-180PREDICTED: myb-related protein P
TrEMBLA0A0D9VVV50.0A0A0D9VVV5_9ORYZ; Uncharacterized protein
STRINGORGLA03G0224700.11e-175(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP74203750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.21e-64myb domain protein 101